X
Email:
sales@ruixibiotech.com

ENF(T-20) Peptide,Cas:159519-65-0

Enfuvirtide (T-20) Peptide

Catalog # Pkg Size Price(USD) Quantity Buy this product
R-M-1382 1mg 210.00
- +
+ Add to cart

Product description

Enfuvirtide is an envelope fusion inhibitor used to treat HIV-infected patients. The peptide binds to the HIV envelope glycoprotein gp41 and prevents viral fusion with the target cell membrane. Enfuvirtide (Fuzeon/Roche) was approved by the FDA in 2003.


Appearance N/A
Molecular weight N/A
Purity >90%
Solubility N/A
Cas 159519-65-0
Synonyms Enfuvirtide; Fuzeon; DP178
Sequence Ac-Tyr-Thr-Ser-Leu-Ile-His-Ser-Leu-Ile-Glu-Glu-Ser-Gln-Asn-Gln-Gln-Glu-Lys-Asn-Glu-Gln-Glu-Leu-Leu-Glu-Leu-Asp-Lys-Trp-Ala-Ser-Leu-Trp-Asn-Trp-Phe-NH2 or H-YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF-NH2
C Terminal NH2
Storage -20℃, protected from light and moisture
Transportation 4-25℃ temperature for up to 3 weeks
Stability 1 year
Document

Related Product