ENF(T-20) Peptide,Cas:159519-65-0
Enfuvirtide (T-20) Peptide
Product description
Enfuvirtide is an envelope fusion inhibitor used to treat HIV-infected patients. The peptide binds to the HIV envelope glycoprotein gp41 and prevents viral fusion with the target cell membrane. Enfuvirtide (Fuzeon/Roche) was approved by the FDA in 2003.
Appearance | N/A |
---|---|
Molecular weight | N/A |
Purity | >90% |
Solubility | N/A |
Cas | 159519-65-0 |
Synonyms | Enfuvirtide; Fuzeon; DP178 |
Sequence | Ac-Tyr-Thr-Ser-Leu-Ile-His-Ser-Leu-Ile-Glu-Glu-Ser-Gln-Asn-Gln-Gln-Glu-Lys-Asn-Glu-Gln-Glu-Leu-Leu-Glu-Leu-Asp-Lys-Trp-Ala-Ser-Leu-Trp-Asn-Trp-Phe-NH2 or H-YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF-NH2 |
C Terminal | NH2 |
Storage | -20℃, protected from light and moisture |
Transportation | 4-25℃ temperature for up to 3 weeks |
Stability | 1 year |
Document
Related Product